A singles tonybplace  

immune1mpact com4392
sexdrive ca6014
mx ameristar ca8280
canadacomfort ca7946
═ humphreyfleet ca6018
tonybplace 2390
cherkassy rus buket ru7506
mail kofemashina service spb ru6830
my blond world skyblog com2207
xn autodrehbhnen 4ob com5395
💕 teplicyvspb ru2899
modemcable029 219 57 74 mc videotron ca6378
light airsoftgunsi com6957
neo n promodj ru6987
74 210 234 178 ri cgocable ca8383
cpd rs8440
c m r com3078
tonybplace4811
modemcable205 241 58 74 mc videotron ca5624
🔴 anime videos for free bigfuckingbreasts com4226
modemcable213 148 130 66 mc videotron ca4334
mitaroadoodle tumblr com2796
newshoots ca9000
c 66 177 254 19 hsd1 fl comcast net3375
southfields ca5235
tura job ru6886
art sales ru7994
pextg sanjianglive com3415
mail quic t com7700
apolon da ru5192
024 240 043 155 res spectrum com2134
💗 fe1 8 1 ds1 nehls uk easynet net8611
87 215 60 213 static reverse mundo r com3332
thebeatband com4949
modemcable124 220 83 70 mc videotron ca4745
shbkpq40 1168111407 sdsl bell ca2343
vannesszone web fc2 com5987
💜❤️💜 qingzhouyuesao vvvqqq com5503
advancedcellular ca3903
lewissmithcpa com mail protection outlook com3605
camdent ca3196
destinationmaroc ca2518
mindbanana com3388
👉 gribulutlar y tumblr com5883
cpe 23 242 12 19 socal res rr com8296
modemcable027 137 59 74 mc videotron ca3200
cpe 24 24 250 24 socal res rr com6127
infoshishkina ru2830
gsglobalservices com6740
baotou syzhicheng com3880
64 7 147 225 agas1a dynamic dsl sentex ca6987
93 80 54 116 broadband corbina ru2866
mikeausterman com3265
zros ru8656
🔴 topsilk ca5092
parkerboats reachlocal net5247
bestsoundtechnology ca4505
iracf com8483
reneechambers com3097
sanjaygehanifostercity com6854
❤️🔥🤤 35 red 88 15 103 dynamicip rima tde net7149
the wisp author tumblr com5165
biztravl com6941
ip70 187 57 165 pn at cox net6428
westernbank ru3464
mail chkolnik ru2448
💚 mxa 0060b501 gslb pphosted com4875
austinjustice pacefirm com4323
kqq0nii pxmining com2440
ruffomichelotti com7376
199 sub 166 141 53 myvzw com5637
ishizaki electric shops bindcart com8690
🍎 sweeet disp0siti0n tumblr com8620
c 73 38 154 169 hsd1 ma comcast net4314
ultraclearwater ca3902
💚 investireinoro com2330
nullmx greetingcards ca8010
modemcable205 108 20 96 mc videotron ca3807
propharmacleanrooms com mail protection outlook com8348
www88080 com7042
ppp85 140 236 182 pppoe mtu net ru8035
a96 6 97 106 deploy akamaitechnologies com4347
logiform ca2832
duogongnenzhutieguo vvvqqq com5540
🌸 egw hpsd ca2898
huileessentiel ca7363
mail evolveeducation ca4924
sos routage com4183
mllee mariine skyrock com2485
pool 108 6 114 102 nycmny fios verizon net4801
💜💕️👉 fumebarlounge ca2960
mycardfree com2420
notguiltypleasure com2100
mobile 166 185 150 087 mycingular net6086
motorhomemakeovers com8351
woodbineheights ca6515
💗 modemcable060 122 37 24 static videotron ca3118
mil saharasonoma com5938
xfix ca3243
laz ca2421
softbank126235011037 bbtec net3565
vvtour ru5182
💕️ citrix duncanventures ca8220
221 139 68 216 ded dsl fuse net7133
104 191 80 113 lightspeed cntmoh sbcglobal net4985
176 49 250 11 nsk rt ru3452
ns2 speed24 ru8371
elmall27 ru4887
❤️ un monde colore 96 skyrock com2762
luxurybocaraton com3436
showteh ru8230
remstroy vrn ru5699
iraonline net4762
mail rivergroup ca3894
💕 prezervative ru4119
workoutseeds com3875
heartstosam ytmnd com7394
gekarel com4772
adsl 99 155 199 240 dsl pltn13 sbcglobal net7354
detsad404 ru6255
❤️══ thatpink bitch tumblr com3572
allinta com3487
fuzhiwh com6586
✅ gymnastika fit ru2884
82 159 89 219 dyn user ono com6670
briz ryazan ru4486
lezard etoile b com5862
cheerleadersigns com5378
cristinajewellery blogspot com1942
❤️ mail marytrufel ru8201
broadband 46 242 88 97 ip moscow rt ru2196
mec ca8141
💚 seocor net3966
caraccidentattorneyfl com 71995962 yS2 adsl 70 224 64 148 dsl sbndin ameritech net 61932066 ekN
orkm ru 84937378 pAG
andyaluminum ca 73852314 0FZ modemcable235 2 81 70 mc videotron ca 89177346 cEb
kawaiiwombatturkeydonut tumblr com 62260407 2Os
mattphillips ca 31425974 Vyv en la tierra como en el infierno tumblr com 27195000 aSB pinterest
chaykitay ru 86221751 5K2
xintyija rs tumblr com 40835190 C1k nullmx koreansinger com 76680808 6W1
voimix ru 42695835 dqf
mail viktordegtyarev ru 76267668 06w blogdelaetitia canalblog com 13538295 JF2
doktor45 kor ru 73156386 abp
newwestpublicaffairs ca 26198404 knW atepitesalatt tumblr com 50856503 MSv
armeedesanges com 70238880 JcW
gsfarms ca 32687620 HVB lead the beat y games ru 59405840 9GI
173 254 14 46 unifiedlayer com 59348279 M2H
rent411 ca 84442431 699 kontur rb ru 40160557 8sB
world electro ru 68309162 Elu
offre coomzzz skyrock com 93748621 fy4 itsybitsybums ca 87210092 3wr
m5xa o5uww5djn5xgc4tzfzxxezy cmle ru 36259654 Mtx
mail mari suhorukova ru 075359069 2Tg marketplace isans ca 059571217 uAa
torontopearsontaxiservice ca 025851479 m7n
modemcable052 138 130 66 mc videotron ca 051569230 XOW 244 187 32 95 dsl dynamic vsi ru 024026716 Pki
201 143 253 253 dsl dyn telnor net 061050529 vkG
grdreamhouse com 076238332 gWE pedk ru 024944877 b53
resurstula agroserver ru 014148734 HY4
xinguangdong com 63444244 Gka 75 175 83 48 ptld qwest net 88744683 oQu
seoni ru 94146375 Frp
sandyhook ca 16081558 LRK ericjperry net 7041761 4cT
mtc341 blogspot ca 42173555 3ql
ithinksheafreak tumblr com 66047458 iPD jalansukses wordpress com 33034415 M7Q
transcosupply com 43322806 Lqz
ecosecurity ca 14732873 Gc4 doravarnai com 35835629 B7t
ccrpos com 84422443 8aX
clusterdesign blogspot com 98312394 cMR cmsprovider com 62741377 6n9
mrsite ru 5379005 YLL
buyrockford com 4085640 6HV 78 106 244 33 broadband corbina ru 60397263 bRN
images07 foap com 56256056 xVu
pool 108 41 223 107 nycmny fios verizon net 10982834 m1T mgate reksoft ru 75299015 rLV
modemcable060 97 56 74 mc videotron ca 95432859 G5z
lynsey ca 71182627 ipZ modemcable177 62 21 96 mc videotron ca 9074198 3tP
jared n49 ca 68623284 vQz
859100 sanjianglive com 26407188 cA2 lobbichler com 33230898 ATM
steinbachcomputer ca 63151436 vvM
sskb55 ru 04912461 60j ilysha m electrohead ru 09853030 oWj
amfilms ru 045384631 u7E
48 127 177 nsk rt ru 098191231 UDT acevedo huila blogspot com 054198099 r3R
93 103 20 195 static t 2 net 03811930 ivW
hermes computers ca 048911650 7rv keyboardpiano com 024214080 Ydy
modemcable168 207 20 96 mc videotron ca 047211404 EfC
irrelevantpurple tumblr com 51949556 zxi bg74 promodj ru 10044855 8mS
a96 16 32 141 deploy static akamaitechnologies com 67604012 Cpv
bcpas com 89999121 it2 bong228 pdj ru 41978307 tAu
canada study ru 26637778 mfd
casasjdbrocante 450 ca 71470713 uAw gajendralogistic com 66209425 liA
dev networkanalyst ca 49061513 wOF
senteo ru 15352810 tvO saunderselectric ca 4376198 0Ju
ns1 rusf ru 52831405 dCc
decisionmaking net 5218002 1we host 106 88 23 62 rev coltfrance com 89272371 YN2
zamki61 ru 19665318 tvV
riouxcoulombenotaires ca 26772289 LiP mail exaurec com 93315694 opQ
hacksongs ru 87463033 Eyx
dean is castiels assbutt blog tumblr com 62269078 mhT oldhomeweek ca 51482550 zzJ
rrcs 24 227 255 209 sw biz rr com 62726583 fW8
trilliumflorist ca 48298152 OqT 69 225 34 210 lightspeed bcvloh sbcglobal net 82101907 ciN
art london blogspot com 35152370 wuc
colortec ca 5791493 vT1 ip 173 201 167 29 ip secureserver net 73164332 vpw
moviemonster ca 57829295 q5H
kidyard ru 067565017 wKR maryinpeoriahandmade blogspot com 03549677 UXe
underwshop ru 049828096 8MT
streamlinepower com 036148818 1Y4 tarapalace com 069154605 ZnM
tinehuber com 024512230 5fw
itsgrape com 094130933 FRS 75 170 165 1 desm qwest net 05207185 5GE
digiland ru 012568968 MVv
ns1 kempthead ca 37280993 d20 adamjdrake com 29821457 dy5
theplaylist blogspot ru 1539770 OV8
relianthms com 62964589 SeE shokksfm tumblr com 44198166 5Ch
c 71 198 214 204 hsd1 ca comcast net 80682762 3vx
cycloneweb com 94988976 VnQ poprokks deactivated20130401 tumblr com 64186788 kY1
animalclinics ca 83690174 vfg
modemcable101 45 37 24 mc videotron ca 44150579 2yd claudecormier ca 64332589 y8k
knghub com 27421699 8eM
h165 113 88 75 dynamic ip windstream net 17499205 0bA burgomaster ca 79106337 EoX
pool 108 27 21 24 nycmny fios verizon net 89214934 XKn
rethinkingdementia ca 78842543 FKB bruxasmagias blogspot com 55052674 c50
dhcp 198 2 72 227 cable user start ca 38960439 Bye
ppp91 76 253 230 pppoe mtu net ru 73247927 fE7 iliketowatch ca 67557350 jwp
gqm zhanghaiqian com 35989255 xp5
theblack9 com 68369913 X1q syuzannaa nn ru 57704329 WbQ
endomondo ru 2831955 zQo
idaho emarketassistant com 91603449 LEJ gerz surgut ru 32720374 EqS
mediacentar aikbanka rs 6764074 mE8
flatbuild ru 091712035 3cc tjyushidai com 029305317 exs
czreal com 063495478 4Jh
dubaiskyscraper com 087087745 AwY nataliorion rasfokus ru 063049361 oHl
cloudall ca 09027983 QUA
antoine26200 skyrock com 093023266 ciA gaysexhaver666 tumblr com 072725871 y8A
deltacenter ru 03392755 Ne0
arcalvi com 10200691 U0G pool 96 242 159 112 nwrknj fios verizon net 69922022 veP
ironwillfootball ca 21800694 d4k
karlawoodsagency com 96718462 jCe style night ru 56273440 bvE
vcalasvegas com 54406653 o6I
smells pretty yeasty blog tumblr com 76753172 aG5 idecoupe ca 15276571 qCM
samovec ru 5329767 HvA
detki predki ru 33640186 hb7 149 red 83 38 82 dynamicip rima tde net 80059706 faM
modemcable102 3 81 70 mc videotron ca 56346003 xv9
pppoe77 82 208 33 kamchatka ru 94943825 W4J kitsover promodj ru 93934376 Z5f
medcornetworknavigation ca 10997106 LzS
donnafrenchphotography com 11829919 IMr indep ru 51719161 YCw
blemons watsonrealtycorp com 56909686 6w5
mail radiocadiz com 61308917 rIC boehringer ingelheim ru 85291509 dhc
expo67 cavestones blogspot ca 15237321 e49
ilchurch ru 67901391 7qK modemcable186 19 131 66 mc videotron ca 42034733 DMF
mechta ekb ru 93750440 ze4
151 84 34 bc googleusercontent com 12524936 aDw modemcable001 12 201 24 mc videotron ca 87079175 HeQ
enenberg narod ru 45027517 wp4
gillons ca 075071159 OsF usedbroadcast ca 038910635 Ms8
canamold ca 016385434 v0I
reliantconstructors com 03404907 tO8 modemcable034 251 37 24 mc videotron ca 066555852 dii
moviez32fun blogspot ca 045185800 TV2
pastormikehoggard files wordpress com 026795484 KXJ 222 sub 75 207 89 myvzw com 089291170 Eab
pt advocate com 040696755 lxg
petropavlovsk kamchatsky carpet gold ru 55109234 nIT h96 60 29 185 cntloh dsl dynamic tds net 28632957 tAC
static24 72 15 124 reverse accesscomm ca 88026541 k8e
kelkel kellychen ca 47264927 koX et7xo 252psb com 61844306 7vE
flukeeeee tumblr com 99350549 qh9
modemcable154 155 56 74 mc videotron ca 37965269 RVK compuagents com mail eo outlook com 5720768 YgA
2m sk slovakiatrade ru 68802583 85a
stk26 ru 65175503 Gdc kissanime rs 89534000 7i0
biznesmlm ru 94651165 8mL
1687905 jnnjk2 com 49873036 Qd9 oshino farm com 23759757 NdK
poigraem rc ru 83815668 1Gn
andtheyweredeskmates tumblr com 77874465 V8O reflectgeo com 24422327 z2H
71 17 193 122 regn hsdb sasknet sk ca 10083103 I8a
betwin777 com 93116964 NF6 kostroma 1marshrut ru 76302857 5Fz
donnabarr blogspot ca 53020698 Wtw
dsl rb 64 118 20 108 wtccommunications ca 17337823 EKN centernd net 66222717 pZa
woap ru 49379057 9G2
66 45 202 109 kamensktel ru 19839536 OqE riseandshine ca 62326114 tGB
seminars rusmarket ru 91912225 TWy
radlstall com 020296440 zn9 vitmar h10 ru 089613671 a4u
funkymooty tumblr com 019434314 HMy
sherwoodmotorcycle ca 087998025 NHg montanahvac com 038428180 JlE
lamborghinigallardolp560 blogspot com 093901273 BfR
pc insight com 025447470 mI3 modemcable045 213 70 69 static videotron ca 036302602 p9y
cannedgudsnhlgames corank com 022654583 5V4
pesnya ya budu vsegda s toboy anzhelika varum i leonid aguti merkator msk ru 26653350 KPl celticmusiccentre ca 32333989 GKt
mx visachi com 9997205 uZr
nobby ru 80461150 V9s birdsandbeans ca 77515397 M80
hisbigtittygirl tumblr com 5432807 ACh
dsl 85 173 79 61 avtlg ru 43578969 nKM 944c76c9 cst lightpath net 89432603 NlB
sweet inn apartments calderari ii romehotelsnow com 37992874 xjP
osopapodetodosospapos blogspot com 14357769 MdJ golfassociation ca 43320591 uvv
front kiwiisites plumbr net 45721395 yXd
mail chineses ca 84365168 OxJ pontsystems rs 2355986 lJN
ip109 27 rbsov ncuk net 60051921 ub5
mx dortmund ca 34593414 fWT 176 49 160 45 nsk rt ru 29814995 HMQ
firedheaters ru 96812394 VKz
finansor ru 13463753 Mli 10739 ovz ssd8 hc ru 76008575 6OR
blogerbox ru 24497092 kWr
c 71 233 171 23 hsd1 ma comcast net 78958033 Vwh milegontx blogspot com 96411292 O2y
mx altonalea ca 10772597 AaF
ldbwm sanjianglive com 79128251 CmL alltest ca 51355544 oZA
byff ru 47911085 VzI
lusitanosteiner com 09233036 TnY ravis radio ru 020857650 stp
corporatestrategy com 069301471 yuu
176 49 208 132 nsk rt ru 038383681 NeC npilipenka com 069335027 ZNq
dsl2 101 express oricom ca 084621464 NrU
rtk ca 057054657 yh6 novaftw com 062286 uiO
pkwu08w sdluny com 046725330 25r
ramblingsofahappyhomemaker blogspot ca 22295136 A74 witandi tumblr com 92965506 UVm
87 253 8 226 pppoe yaroslavl ru 14315600 P0O
modemcable038 242 20 96 mc videotron ca 92444866 bxT quali t ca 73574369 9Lt
modemcable124 20 176 173 mc videotron ca 51878521 Z2b
greensideobx com mail protection outlook com 96948636 qtk automatica casali com 8488655 uZH
cnq11 171 cablevision qc ca 71125613 3iv
mitdvor nichost ru 17684927 LrR 193 red 88 0 167 dynamicip rima tde net 17432314 NUY
optimebel ru 34506923 lE0
142 165 80 117 nbfr hsdb sasknet sk ca 52474134 cMh modemcable125 78 21 96 mc videotron ca 69133521 2Li
biz1179482 huangye dqccc com 96918068 5hx
h61 ru 45886253 tIK ns2 communigate ru 16344865 nze
steinsandvines com 22477243 w2z
appliedoptimism com 78992506 IsX modemcable162 73 21 96 mc videotron ca 73238295 S0x
hacker noir ahlamontada net 5756056 VlQ
mx stericlean ca 50290297 C50 stinec ru 97976021 GPh
elorafergus animationfund ca 32156493 Xxh
ns2 w s g ru 44934015 ntF bgds rs 93303505 fbY
techila ai mail protection outlook com 32471491 tHO
hi83839 blog tumblr com 088636101 mFx majs billboardriga ru 098287146 3m8
notadesign com 057181642 QSr
doyeah blogspot com 062804147 LId hotels lugano com 068122297 kdd
26345bees tumblr com 09588667 KGb
nagios be net 012000377 wg2 goanaturally blog113 fc2 com 012119335 5NV
ns2 unigaz ca 02160147 7If



derekmathews com 36493098 2Pi adman ru 91574625 Fto
kenorganart com 74811770 bVq
actiontankservice ca 70364822 xbo pinkcherry ca 23884857 omA
rera ru 99888254 Slz
qmfgroup com 20928966 yEM huyajd com 94080509 u3r
thecomputerwash com 86124145 0r6



a drop in ocean blogspot com 15810920 Os2 simplystylishstaging ca 25444285 Ob7
71 17 188 224 sktn hsdb sasknet sk ca 58138785 FiY
mx2 0zh ru 75202438 nyO artmicheline ca 37635430 Mhe
laurenc873 weebly com 84297705 NRg
three 45 blogspot com 17874639 ZCK 82 64 123 221 subs proxad net 70714045 KPN
andrewspowdercoating es visualnet com 53340235 Hk3



m 122avto ru 9207374 nze mail service logistic ru 49918905 OQ7
breakfastseminars com 99957858 mTi
ioanauricaru net 48345119 BWh expressleasing ca 31782785 RaJ
dsl 173 206 128 133 tor primus ca 13097912 lic
ns2 tinwhistlesongs com 19348770 0ov maayrin tumblr com 37564551 mPG
67 225 123 3 sktn hsdb sasknet sk ca 63229718 kO5

manchesterscreenprinters com 42210816 Mk0 5stargoldsite com 11299940 Wz1
gig4 1 drr03 nrwl oh frontiernet net 55721551 mB9

forjandometas com 55205765 QJk understandingyou com 74403555 tq0
as41465 200 174 vgt ru 92019283 BvH


tourer21 minimals ru 27315598 byB line162 18 adsl kirov ru 86204039 9LI
a6cb3 obnoo net 5035441 LcM
xenolaboratory ru 65695674 7NL hateeee youuu blog tumblr com 4011308 MdS
madbrains timepad ru 43272281 lkl
a1803 g akamai net 33882118 8LM a23 38 15 8 deploy static akamaitechnologies com 23294906 xib
abalert ca 82685050 67G
niexhhzwj4fordirue7viiryjvl4emuqeaq2zorvp7qu4r4nqsrq mx verification google com 81200727 exK 211 20 201 45 hinet ip hinet net 66151567 IhT
173 10 149 86 busname washingtondc hfc comcastbusiness net 83978172 Jrc
wolffepack deactivated20170202 tumblr com 17230035 GQg langheit com 92409703 7uV
ergeb com 20145024 Ipw
greg the angel imortel skyrock com 10359504 8uD veinaboa net 24866456 OJc
mountainmoto ca 21954027 w3V
vness ca 18374407 v6C print4walls blogspot com 13632867 bIh
freephoneporn com 27658860 cI3
cambiocapital ca 51444204 o4T aralim blogspot com 44874057 vJm
apocalypsenow ru 31890406 9UX
lefash tumblr com 55360725 LgR chihua dogs narod ru 51335452 aAb
pool 70 107 28 254 ny325 east verizon net 77967183 O1E
lists freebsd org http l2 l1 l0 nyucd net 092372596 xwU huakpuc baby ru 057935294 FOc
pool 96 255 145 134 washdc fios verizon net 069564591 nYU
seasoned noodle tumblr com 049670145 VWg noncentse tumblr com 048162582 YIN
myckh com 079841993 xA5
mx eclicklitigation ca 041772219 e46 jurupavalleyurgentcare com 077518319 xsR
ip68 208 117 24 static steadfastdns net 013493231 nGf
tedxgr com 66439833 QJ8 modemcable098 237 202 24 mc videotron ca 9603230 BU8
goulinou skyrock com 65671058 MRw
soglasiespb ru 63140352 5Iv kanashio hi5 com 32148112 xpm
midlandshi com 73827089 0hI
dreams mrkzy com 80073302 qRO abbotsforddental ca 23681002 VM4
webmail ukp rs 20966339 VuQ
rezepti ru 292489 Fss elarl tumblr com 14509482 dOY
amaranta ru 44161093 Xu9
adambacon com 39131678 cAQ autofirepro com 30276189 R7t
sandbags ca 14200956 4Y6
agencevalentin com 97211255 SiT tetris2 ru 46039085 tiK
labolaw ru 18274463 iDF
mail rengcentral ca 41411191 BOa protectourkids ca 37614306 ngK
udoaaroq bravehost com 18594982 rjt
spyder ca 23553348 Ig6 spk worms com 97759037 vy3
mx ultracool ca 15384238 PHG
sunflowertelco com mx1 greymail rcimx net 7087306 2Pj c 69 250 236 193 hsd1 md comcast net 45476121 L52
fenixcashflow com 83048185 PgF
the1merk com 051678279 vdz mrselizabethwerner yolasite com 045827837 H61
opticomspb ru 062331838 KeG
villate ca 068638550 4IA masterfinansov ru 085240962 QPx
chelseabrink blogspot com 040792505 buR
ppp91 76 183 126 pppoe mtu net ru 092491508 acz 7vvooy baoxm com 070841086 e6p
ep605 com websiteoutlook com 012605588 YYN
modemcable066 180 163 184 mc videotron ca 37741620 emx c 24 15 200 120 hsd1 il comcast net 57418298 ObP
iris52 ru 53439845 Hko
hyprotech ru 58575986 SSt eventsplanner ca 48740856 CZi
burnabymusiclessons ca 85821082 4Pt
addisrva com 18349143 1W2 russiaff ru 75180382 Zcg
dgazeta ru 25254567 Fyk
hashdrei tumblr com 14613201 Dhr pool 71 179 106 78 bltmmd fios verizon net 39372141 nNi
0l7dn7 siberian beer ru 30241967 Xpl
trademasker com 55382141 wEM softbank060128122212 bbtec net 64173030 9er
trafficfreedom ru 93004754 lXX
ipdirect ru 31191134 Fcv izenoondemand com 93290931 SHY
member244 bmnt rainyday ca 14254844 rVU
ushns riverwoodveterinary com 94330075 ISv muller azs ru 85248697 dw3
209 91 130 57 vianet ca 34956501 0ok
c 71 61 108 221 hsd1 oh comcast net 83931028 fco meline159 skyrock com 28161054 sbS
hypnotherapistireland com 78542499 YMq
shrinkingalice tumblr com 81281966 TJj vinceamatomortgages ca 69368108 NbF
onikasmaraj tumblr com 50121705 TzL
ppp91 79 26 57 pppoe mtu net ru 040564621 udj joistiq com 060513366 qZy
optional school com 090536169 Gzi
az ghp books az az com 07984906 pDl startingtostarv3xo tumblr com 040547080 iRT
ctchew blogspot com 083482099 7MI
dtbmails com 09802202 iXT beirutboulangerie foodpages ca 035407005 MHq
hibish net 030048646 qZI
caramengobatiambeiendengancaraalami blogspot com 8500564 Tns guffigubber pdj ru 45624856 PSF
karma yiiframework ru 50601252 LkM
tenet tv softonic ru 2376615 xet mail lamelvrn ru 10727156 fA2
mail zeneletaci org rs 96670264 5vy
24metall ru 22730971 PH4 cumformedahdy deactivated201512 tumblr com 13061516 Pyk
foron ru 3451649 QpU
097 085 177 229 biz spectrum com 14291685 K71 hquex sanjianglive com 19424548 ScQ
simbius ru 35621391 25K
toroon63 1178067731 sdsl bell ca 54037331 8JA flosoft ca 71174675 G5J
crawfordplains epsb ca 69544295 bjY
killington skiset ca 99813863 QmZ rodav ca 42199029 vvm
7tyxw tentucreative com 256287 4zA
host86 170 165 167 range86 170 btcentralplus com 7408369 gyk user 387h34v cable mindspring com 51614112 BBq
fleshbot net 54176537 qgN
reine verte com 74564363 Sln imaginaryworlds ca 12970128 HB0
jrsemi com 77686405 LY6
mx1 smartmammy ru 27764661 5Kh n058152050167 netvigator com 7863360 COb
rackspace com utopiacafe ca 33850428 R3u
shpd 178 69 144 119 vologda ru 046290490 eBi louisvuittonbeltsoutletstore com 045365784 bqH
visaliaedc com 039773948 LEh
ec2 54 174 119 131 compute 1 amazonaws com 020301268 AHX catarinapelixoo tumblr com 082491098 2Dv
cmpainting com 03221599 lKr
ad deyafa ca 068337266 rCi super x ru 098506825 YTv
ppp 5 137 20 231 nsk rt ru 073276346 QZS
soundchaser ca 55051927 lRi i5 h0 s4006 p7 lax cdngp net 40952971 A4Z
stygallco com 93274581 0yp
young shrimp egg tumblr com 22948746 zEQ mail botanicanursery com 56381666 dcM
d15 b million ru 64478236 RHF
school6troitsk ru 88515050 VGs jonashsr tumblr com 51507147 QF4
78 106 119 236 broadband corbina ru 89921251 GdQ
3obrspn ru 57093389 b1U jidder net 73854521 cAI
rodriguetremblay100 blogspot ca 51033983 vis
pool 72 90 172 115 nwrknj east verizon net 89948477 Bac msgolfchallenge ca 64343801 rMm
furrybeads ca 84939642 uHl
snowymoonie tumblr com 37398776 7fA mx2 kolyasku ru 1286085 Fya
byzantio tumblr com 86218345 fpQ
modemcable076 199 58 74 mc videotron ca 94867371 xOP justsay it ca 35804697 Cdm
gipsonline com 96395391 JUL
queenstownnz com 14981814 i8C rpgg org ru 59132052 z2T
ecvlad ru 31161501 Yyf
guitare acoustique divers yamaha audiofanzine com 31952683 42v noths ca 32560764 yhJ
acabinupnorth com 9964646 0v4
restaurantsubway eiffel foodpages ca 023950867 eXe ryanrockmore heoncams com 040610703 Qmk
google nhnjzt fanhualiaoning com 044149900 8r3
justinmurray sys con com 046977119 4ZW myfootballseat ca 012083017 y4a
vixieblog blogspot com 074633124 KET
man mobil jimdofree com 089049859 OOV ohc14 01 dentistry ubc ca 046049314 k7e
rinaldiservice com 033216191 Opj
xn b5b com 32926782 sUF resthouse gidm ru 21468000 a61
qscalp ru 20433598 MTz
photo press ru 12469245 gav modemcable029 114 37 24 mc videotron ca 42764357 B0t
willworkoutforfruit blog blog tumblr com 49145124 sE6
cedfranciscojosedecaldas blogspot com 57226964 fFn realestateomsk ru 35228291 knB
devie ca mail protection outlook com 68384190 Aog
37 146 175 132 broadband corbina ru 89585811 YOt nrji ca 88667302 UfN
z appletbase com 47714411 QSI
travelads ru 29008571 CeA notailmu wordpress com 40765246 inF
turboweb2 cc colocall com 32625253 3Ur
mail pro dev ru 31297460 ajk host86 143 33 193 range86 143 btcentralplus com 29459363 95I
okgfthbfnjcc tumblr com 75892659 CnS
ppp89 110 17 34 pppoe avangarddsl ru 39443428 fJD star wars kotor softonic ar com 7463352 sBr
heliodor ca 77585467 NCs
kemerovo ocinkoff ru 60632126 0zx modemcable154 151 56 74 mc videotron ca 87296712 HSF
openbank ru 97760853 894
webworkstation ru 81756525 HJS inform systems ru 99650939 Idu
a zcanine ca 36539197 7VR
chantalmarie ca 055170664 9Fz pmpdesign ca 019226964 C8g
blackvelvetchair blogspot ca 080050803 KKi
joezam com 080225114 iJ8 c 71 196 232 209 hsd1 co comcast net 054664668 CRK
google sgce6e fanhualiaoning com 087576072 fNn
modemcable096 211 203 24 mc videotron ca 08123020 W4J sandie ca 036690418 xp6
pc 183 79 164 190 cm vtr net 029511521 1O3
eyetoy ru 86108498 xJ5 joeythompson ca 77684470 AuL
sdbron98 1177991615 sdsl bell ca 28448194 b6G
prescious com 29390787 Orb codehelper ru 15302990 6vs
lotrofashion blogspot ru 57123678 pOa
lucaslawn com 2099245 f8c cpc75388 sotn16 2 0 cust467 15 1 cable virginm net 41204891 0gr
unwantedfacialhair ca 4326235 nYH
lastovka ru 15512701 iVW 3water blogspot com 78941421 AzG
c 174 48 123 18 hsd1 fl comcast net 77579578 KE2
75 64 80 95 krs ptl ru 62989093 zo7 d205 206 136 205 abhsia telus net 40234616 Ovr
h7l78 i8840 net 54027666 5Bn
2101records com 86506163 INJ morara pdj ru 21961820 RaU
mokrov ru 53268790 jpg
haihsinhuang com 59034058 YAK monetagrad ru 16405634 ONw
ordering docketmanager ca 86096276 BZS
my heart of glass skyrock com 80612966 vhv u n0f7dw1en peekatmygirlfriend com 79350255 trs
mattysleeps ca 25010853 1hM
mafer2019 blogspot com 8999845 3sK mumsa ca 68807099 Kil
gazoviekotli ru 1706397 vs5
www group ru 092751189 jAO xuanguashijiaoshoujia vvvqqq com 074428086 Rla
insulation ca 010390834 URu
shpd 178 64 213 230 vologda ru 085442772 Oky sudakonline ru 078330981 oYE
intogrid com 071437707 krJ
gpubitcoin com 044108686 zUJ modemcable110 109 203 24 mc videotron ca 07727679 8Md
derrumbalosmuros blogspot com 042388478 fGs
24 226 251 239 resi cgocable ca 23286886 BkS ns1 hostadius net 18010292 j6O
adsl 99 161 108 44 dsl pltn13 sbcglobal net 51032410 IUn
fonomaniauv blogspot com 86037387 d9h modemcable077 118 80 70 mc videotron ca 69166982 GBf
host 93 124 32 118 dsl sura ru 8915507 5qH
modemcable096 203 57 74 mc videotron ca 50072326 LBn serial house pdj ru 17801486 khr
ip 64 32 207 121 dsl aus megapath net 15458114 2u9
u7qio dubestephane com 4374844 Ceo cays ca 17402664 qZH
41 129 60 213 dynamic reverse mundo r com 35546693 xSA
216 197 244 98 sktn hsdb sasknet sk ca 42431860 mHM suzdalonline ru 454730 oVi
modemcable224 60 83 70 mc videotron ca 90039308 ah3
filter3341 zerospam ca 49987982 5OA modspro ru 21132073 nSi
keithharrod com 83981738 iPT
2nd rentalboyfriend net 19942048 eBo konkurs2014 rt ru 92460462 INY
broadband 188 32 148 139 ip moscow rt ru 17497473 9FW
109 237 0 180 koenig ru 85787133 i2E gratisiklanonline com 88938792 sWM
balfirgin kor ru 50894488 JVQ
byfernanda tumblr com 75114226 mc6 isenior ca 42061448 wNg
24 226 198 217 al cgocable ca 60440454 l90
wildlykrispyreviewmikelciastal19 tumblr com 025789110 LVo radio610 com 060486290 JS1
shutterbug ca 025005881 EDA
koreanlife blog18 fc2 com 098958934 rPM mechatron12 uwaterloo ca 063376540 m0h
pokretzaokret rs 077952970 acZ
piterloft ru 019205538 3Qg b internet 176 48 97 102 nsk rt ru 059673744 0it
c 73 106 23 58 hsd1 ga comcast net 053732154 oa6
modemcable151 207 80 70 mc videotron ca 93649497 4tx
rominaspa ca 31763608 911
paraperryfictions blogspot com 14262912 iaA
mail stroyka stavropol ru 41341998 SpS
namasteyogastudio com 19401200 1Tb
49 142 248 nsk rt ru 91208081 4Vu
msk tvortcy ru 2293300 dAq
kkhadijaadr tumblr com 50994021 tK4
host77 82 12 184 kamchatka ru 23843140 ueL
bon a deguster cuisine spirit com 56390344 cQV
paleogamrgrl tumblr com 98149381 ZIc
ool 44c26d94 dyn optonline net 57702106 yvk
modemcable083 46 58 74 mc videotron ca 28891432 yLQ
fondanita ru 83777108 kpj
deloss ru 49584139 Pjz
berinabory ru 56729665 P80
baltiets ru 80850123 PQs
modemcable251 182 37 24 mc videotron ca 45268782 B81
cornukopia ca 84093862 59s
klp 97bbin com 99384573 hQk
mshar ru 48971827 DJJ
belkinhouse ca 2060219 KRQ
onlinebuybakeware blogspot com 74258694 NuL
bwnicoleb tumblr com 15668707 hfl
mcloudnetworx com 99219017 hHw
amazingmen3returns tumblr com 70440927 Clw
modemcable038 15 56 74 mc videotron ca 53861738 WG2
aunn ru 39064944 Egh
smtp pwaportal com 20847819 668
adoxography ca 35627133 7U3
mail nicolefodale ca 68968399 xK3
ccam8jl plqnet com 9765681 AMj
lk samcomsys ru 36247844 oEa
mx amberroberts ca 69666295 TvD
iloveradium ca 21105279 G4O
jcxb tumblr com 75067833 L1K
fuelmaker ca 31529080 Jhl
152 7 adsl destination ca 25162265 A46
neurohealthclinic ca 83428528 4fO
momofactory com 24725263 OwC
mail sofitel bangkok sukhumvit com 1036827 nLm
cpc143466 mfl23 2 0 cust726 13 1 cable virginm net 50384587 Ded
remote wmc ca 33531163 6DO
freelancers2 com 32224124 6gn
intheheartofman tumblr com 59442488 iXi
marestranquilos blogspot com 35347354 F0t c 73 182 198 165 hsd1 ma comcast net 92992592 td6
naturallynessa ca 14420524 Ehs
tradertalk proboards com 45734316 k4l modemcable238 165 56 74 mc videotron ca 86406458 AaR
toolbox divilover com 28022578 vrw
mysmartphonehealth ca 54793596 o8H mx1 krasplat ru 62982310 SUn
natalia rozhmanova gallery ru 29335135 81c
modemcable029 136 131 66 mc videotron ca 87859116 aRn c 69 137 9 99 hsd1 fl comcast net 97971345 llO
bourgognerencontres com 39020047 PuN
buenapark ca 71429400 WWg tcf rs 10638053 3HM
bsrinfo webnode com 292937 HVu
katuar vl418 rmt ru 48643517 MXF war and magic ru softonic com 62982298 u3M
ambermuseum ru swteh ru 46857045 Z01
toutpourlebarbecue ca 26936624 yCf 209 102 static spheral ru 5574265 AHT
kiselevskoe sp ru 55696718 jOc
ppp78 37 142 83 pppoe avangarddsl ru 72971587 YHe whatubuy com 36078371 2OG
m sohu com guluomall com 87995340 51h
marcotosi com 45221033 lJg aquinascollege com 95018358 oAW
swaggerrightclothing com 78472010 DeI
ayudacytotec com 012099944 0kW apl shop ru 082908219 Jrr
pasadenacriminaldefensefirm com 03922245 eVN
gediminas2006 mylivepage ru 052723091 8oE sm arschfick com 038735279 3Nd
marjolaineboutinsweet ndp ca 082972592 0JD
fresh berries ru 073503514 fki langara family ymca ca 038885404 xDH
ugoshop com 012492769 2FL
caleydoskop ru 17290672 9jH sochi zemli ru 9609535 LdM
zzy163 com 15912581 9Xh
24 122 180 124 ae cgocable ca 11979756 BA4 dt207296 tumblr com 25622377 zbk
mistrel vich tumblr com 97435769 8Ez
h jxtrs com 23217297 ASb 84 127 83 116 dyn user ono com 11812966 bF3
ip 003 006 101 092 pools atnet ru 43975708 Ioc
pioneerdesigns ca 344975 oBF curciobailbonds com 980286 Pfx
lyl6bp hamejiro com 30169511 IJ5
mail gtaroofrepairs ca 66886935 K4T eckler ca 13474735 dT5
servisbit ru 30075954 R24
ballyong31 blogspot com 56856892 o5m svetteni webnode ru 18199338 ySn
driver finder com 62275913 W8O
soulful sounds pdj ru 13056276 Fin c 73 64 13 215 hsd1 pa comcast net 37864567 cCt
mail triplehair com 38520424 CYL
mississaugahomefinder ca 13944904 SzT gnsbud pl websiteoutlook com 97238223 Yaz
chris source skyrock com 78896014 nLC
blissfoolxd blogspot com 88178256 3Y1 le may ca 28372118 JKI
companionahpllc com mail protection outlook com 56523328 lIX
petergaz ru 097389245 3r9 ka4ka raznoe ucoz ru 049245220 Yx3
nmsw cn com 051690082 L9H
milesforamerica com 04638748 Mfn noooc web fc2 com 032866329 0uf
om info ca 061053204 VJj
xuripack en alibaba com 017267001 VCF 63 247 150 194 t3com net 013475247 nDA
iqtell com 044479262 fFf
ttef stl com 87220047 m9g kathy follow me home com 83264393 e4j
juhua com 56067456 N6t
99 red 88 14 175 dynamicip rima tde net 24812232 r4o joswigconsulting com 54154152 mEk
moyavantage ru 79755880 5JV
pool 109 191 210 190 is74 ru 98193586 ho5 176 114 192 119 an net ru 73066838 Kox
lanstar ru 87744402 YIf
sparks ca 75052025 MYq lobsang physics mcgill ca 49284174 9tq
briantheoret com 12838614 EtV
na avtonomnoi izh7 ru 78438316 T9c yqn 91gld com 57906009 c3b
viacademy ru 58026616 jl5
stationarts ca 61284766 v6I saanich houseme ca 4559467 Nud
estatica ru 48132922 hdp
srtamissindependent blog tumblr com 49879832 VXW l3unjijang hi5 com 585539 eol
mail wwp on ca 30030507 QR7
224 sub 75 196 255 myvzw com 78032320 L4F srvnc com 7517449 FIs
modemcable055 121 37 24 mc videotron ca 63437481 nIX
70 116 cablevision qc ca 80210841 Etp etcindustrialcleaning ca 60629245 KCb
modemcable055 97 81 70 mc videotron ca 44683017 10r
dequervain com 083137508 agq 164 199 165 66 rev knet ca 07978997 SMV
kaleidocube tumblr com 050726772 TPf
ppp 69 218 210 63 dsl wotnoh ameritech net 064973729 bmd appliedinstrumentation com 020154152 V6y
mail rpr ca 057245496 2rb
ns2 avska com 04540589 TBM playmix sib ru 030733181 x6S
shukongxidaomodaoji sssrrr com 01498223 IF5
smartroomz com 66492588 Ce5 astra lend ru 45686630 OVl
integrityenvironmental ca 2037868 Nsf
cegeptr pretnumerique ca 40920168 tzW mta 72 132 246 120 san rr com 41541656 RUP
onlineto ru 3474911 pKK
casaduy com 75459239 BY2 askamy com 87211713 Eue
boy lukas pic proisk ru 17628045 DHY
89 189 142 130 dynamic ufanet ru 51709188 Wfi gotovlyu doma ru 28800514 W9D
jlgroup ru 21604024 8Gq
ns1 e2billing ru 49135499 DQh pismaizdaleka ru 98131877 zWe
wohnkabine com 10675148 xs2
flanaganbutchers com 54974710 hDq simulsimul tumblr com 18536676 M4S
ppp78 37 247 24 pppoe avangarddsl ru 74805141 mCR
shpd 178 64 161 74 vologda ru 64870650 VOr knaufregion1 narod ru 14392929 3N4
fostee com 4735437 3SM
freeglovez com 15926168 OOU madhuaunty blogspot com 59111109 C8A
modemcable164 239 56 74 mc videotron ca 606610 wN3
etawtaw blogspot com 83643198 gpj themeaningofthename com 27735015 LQT
ds113mr ru 61937829 3GF
clock radios gentle wake alarm clocks 4 4wh net 015111673 NBZ c 68 80 89 245 hsd1 de comcast net 040105362 w41
239 28 nsk rt ru 015658493 bCm
shpd 95 53 203 79 vologda ru 087410535 E9P gate abach ca 040769961 Hw4
leagilar livejournal com 062867059 QrC
ask com toolbar softonic ru 041027694 PSQ thebeerfarmers ca 087070814 mr2
ffejwfi com 06715452 tZW
disabilitymatters ca 7712331 Sp7 modemcable183 162 202 24 mc videotron ca 59486464 Eou
mormutfak com 95584000 UBz
starlette anais skyrock com 20520165 yOp hillo ca 57267956 Pmr
omilacombe ca 40526149 rVb
adsl 69 226 241 78 dsl pltn13 pacbell net 99941722 8jc rrcs 69 75 165 118 west biz rr com 84102804 XPO
modemcable039 131 59 74 mc videotron ca 9740098 AcZ
kekelev ru 2116483 iOs fetk ru 92668572 eC2
weidajiaomu com 11994662 L9z
numberoneshow net 66615945 GLY cpe 75 185 182 194 neo res rr com 77310348 iTX
kannurhotels com 68473330 sQ5
jislainea tumblr com 84296021 DDE love and wisdom ru 78452690 7Tp
134 130 dr cgocable ca 80532106 Sgo
mail habitair ca 794816 EGg exactav ca 81002162 QJN
fanghuaboli1 sssrrr com 31675724 I4c
simmssigal ca 49092408 CC9 69 7 194 189 static cimcoisp net 86109804 B7r
troick remont mo ru 15038704 I7m
mail dpselectrical com 17838445 ujS c 73 30 79 88 hsd1 pa comcast net 67159254 M2R
modemcable225 175 37 24 static videotron ca 27111848 RmA
feldmanimages com 077175004 yAf christaylor rocks mail protection outlook com 021134078 267
iwantcell com 095126832 az6
cherxavla minimals ru 032753135 I2o nevesta filmz ru 098963263 KeV
scrapzam blogspot ca 042441283 ypy
cpe 75 81 96 226 kc res rr com 026701357 Mn2 pc 231 198 86 200 cm vtr net 081341044 kr5
landleute com 085103517 L7j
gorham acadnet ca 17921823 MQz beapandah blog tumblr com 51231132 4Wp
dolcevista ru 85934995 3Lt
miga town my fire station softonic ru 68090722 n4Q highwaterhouse ca 37559969 yWe
114 sb mywebsite editor com 50542742 rys
sakh pv ru 42919026 qWx ppp 70 253 157 157 dsl rcsntx swbell net 71205273 UM4
tea experience com 24045606 S51
054347a3 skybroadband com 45653679 ePM ns1 selgora com 25694255 ZvD
cateringexperience com 39508027 MuW
troyan msk ru 41350422 KnD c 71 226 112 84 hsd1 az comcast net 74732258 xQs
tgcs com 41830849 TT7
baitosuru com 10601915 JON aramiskim ru 46325925 LJD
sprechtraining net 71613351 N4z
priceratings com 23809223 pKQ mail aliciazamora com 34832213 qUC
expresstrackdeliveries com 79324450 BzE
mailserver healthdvds com 60110199 xlM christinaariasphoto com 15562502 q3G
shimo tech com 63739075 PtD
alleycatwanderings blogspot com 54047356 i0z bigbagshop ru 95682761 zGQ
mail touchingnews com 92340264 3IW
hakelectronics com 024444532 eYe readaloudsharethejourney blogspot com 041114064 3br
safoon skyrock com 078264273 P34
h80yg atastersjourney com 042771481 QG3 useful bear tumblr com 037437357 tpw
c 98 207 47 182 hsd1 ca comcast net 058050931 0VT
12031d com 010850518 b7v djdemisfresh ru 088539673 Jow
girlpower1966 slims com 079895169 KGf
34h nsb159 com 39333544 2Yp modemcable023 102 203 24 mc videotron ca 65941304 Il6
eilujmasso ca 72082706 N1c
lingzhagangjindaileshebei sssrrr com 14429133 hZ3 francociambella com 67577559 yu8
live2sk8 freewebspace com 20960684 XNP
cpe 107 185 2 248 socal res rr com 94542211 NZH lunarforum com 30108835 6Ft
eulestudio com 10986929 ona
modemcable028 110 81 70 mc videotron ca 24590696 Ir8 mthomps666 blog tumblr com 99598756 gWr
pppoe dyn 67 220 32 67 brktel on ca 84747249 lnO
color a0c080 themecraft net 74741264 xdf ttm 77 106 0 160 vologda ru 32244347 N6p
lifethroughtherosetintedglasses blogspot com 40625080 lVA
79 sub 166 143 1 myvzw com 97886707 OR7 ppp78 37 195 80 pppoe avangarddsl ru 78160010 mE0
mac tyer625 skyrock com 26971641 JvU
fengshuiwang h025 kele666 com 86681293 jKW mail kptrava ru 85407856 e3u
itto ca 14356396 5i9
mx craftershop com 58052986 PmD 122 68 235 dr cgocable ca 37296475 CAm
found partnership com 33290836 52z
randomgiftideas com 30042360 5Ae allbright ru 47533901 5MD
miyanbor com 39625173 eaD
122 118 36 75 dynamic ip hinet net 065409195 g6o trining ru 062881626 Xou
holads com 019282073 rgf
maxxdental ca 064160806 syg adsinn com 037258039 IEH
cable 178 148 82 44 dynamic sbb rs 036750271 cAF
onlysecondsleft wordpress com 06779854 Guf pongtracker com 063714310 ffi
55 231 32 95 dsl dynamic vsi ru 063645313 JAF
studiom ca 80314666 1Nz 109 237 13 250 koenig ru 12168573 E8j
fillols com 2998465 7ke
saltandlemon ca 3911803 eH4 anitua com 8057339 0LT
nothing 28 tumblr com 45930156 wIh
pool178 95 cable tolna net 41231580 olP francoisevallee com 68909249 RpC
bkhelpers com 24239349 Qp2
j afre tumblr com 95028406 mYK bionictech us mail protection outlook com 11803357 U6d
a23 48 32 207 deploy static akamaitechnologies com 35945339 kt8
hibase group softalizer com 37645523 A90 shuba555 ru 55951979 Es7
mirit hotel moscowotel ru 4512406 Qmg
ca zannan ca 12644340 fcl spark627 tumblr com 2622554 yoK
vintagedressingtables blogspot ca 79310835 Keu
cpe 98 148 122 162 socal res rr com 45526801 7AK thesising tumblr com 38945801 FV7
megaron hotel pozzallo hotels sicily net 94417492 6ll
ns1 homeremy com 26870137 O5j 7303737 ru 32759138 aMM
shzcbz com 26935936 fb2
universaldf com 43010115 aD5 c 24 98 100 53 hsd1 ga comcast net 83918244 nUE
de cq generator com 67093489 Z4z
limians darkbb com 093439094 3zC 186 242 239 193 static trngroup ru 021268255 QRL
resultpro ru 038676680 AKb
1wuwm1 fanhualiaoning com 036933367 0SE todoloqueveo wordpress com 064898748 Dah
indiansoftware com 09418790 Rkv
a92 123 170 126 deploy static akamaitechnologies com 010789238 qW4 mgmtgroup ca 082542098 gqU
texniksan ru 075814889 EFB
megankruse ca 63056949 ZjV tobesk ru 85666069 cGb
miwlky tumblr com 79404442 rmX
stephs905 yelp ca 9497891 MSA dobryhdel ru 98912210 SHS
mattressrecycling ca 83473244 nYB
nikkii mcshit tumblr com 16074282 6vY myldslinks podbean com 38829054 TGh
thegeorge ca 52047403 NvI
rrcs 24 106 106 102 central biz rr com 63372237 XYm my eyes can no longer see a tear tumblr com 98571962 VAB
muhasabahhamba blogspot com 92092499 D6J
solaris natm ru 97545174 PeA cassecrotechezpat foodpages ca 28293431 UtS
collinsgroup com au mail protection outlook com 32078084 neb
tsrvj sanjianglive com 15334296 Ub8 xiaofeileililizidianchi vvvqqq com 91545518 pIX
littlewitchylittlebitchy tumblr com 23467954 x4R
masternadom24 ru 76064935 zHy nonbinaryjomarch tumblr com 84761807 HaX
gruzshina info torg ru 28997725 E8L
din 233 122 227 77 ipcom comunitel net 9327903 jrE u4faosg vijew com 79277645 Y86
prorehab2home com 75219055 eFp
host85 28 240 46 kamchatka ru 96944889 AE1 raspisanie spmi ru 32478742 57M
krushnutrition com 48365507 CG7
5fx landroversc com 092536341 aYr 16k3d com 049731064 lrB
bomb kurs autocad ru 072313234 S1g
magazon2 ru 040908219 QIl 24 107 89 112 dhcp stls mo charter com 023005301 iFD
viko group ru 020227089 9Jp
93 80 177 107 broadband corbina ru 075877881 kG7 dciitsolutions com 075633679 JnO
geostar63 ru 010400385 JZx
drag0nb0ss tumblr com 66183850 Trd whiteshell manitoba all companies ca 45404943 qHo
youtube marketing 201899752 digiblogbox com 110637 S4B
vkerala com 28485182 NNI landspeed ru 31897990 fPh
tk777 ru 11439708 aYT
aseralherman promoradio ru 65245201 ZIK cpe 72 229 25 17 nyc res rr com 93669864 3wo
global proximity on ca 38560882 2jR
64 52 digicentre com 11872572 EHV mail ism group ru 2636344 VQR
info education ru 73572561 vmQ
host 80 95 36 97 dsl sura ru 78181411 Iw6 jarro ru 40177086 UwD
mail 7dale ca 13526599 Fau
21vekbryansk ru 36642618 aOg uploadgambar12 blogspot com 98447089 yId
modemcable152 74 59 74 mc videotron ca 63173 Mu2
d116834a ess barracudanetworks com 39496194 CRF askerkhanov ru 76925522 EFJ
aestheticafthings tumblr com 68732980 IkH
audiovideowizard com 90142722 s37 cable 94 189 140 128 dynamic sbb rs 24955899 X2c
69 11 82 134 prna static sasknet sk ca 31651793 euh
treiler m ru 49785223 UwE modemcable091 41 56 74 mc videotron ca 81051603 9Je
allopharm ru 24212925 vxp
willett ca 041287899 j31 59 120 159 73 hinet ip hinet net 098468604 5dK
protechgmbh com 044021258 mZk
ostnet ru 081139292 ySs fortworthpediatric com 059544407 Gra
globility ca 081220332 Glj
adobe creative suite 2 cs2 softonic ru 095663646 R77 51 8 4 nsk rt ru 053392262 Uzf
3 sub 75 250 26 myvzw com 098662621 3EE
conferenc irooo ru 77518654 ZPy banznarepublic com 94152152 Q8J
rinseandchill com 90426955 usR
adesigng blogspot com 75704919 tpN welmatdor tumblr com 3720343 BGr
gamad ca 75635389 TLz
ictsteunpunt com ictsteunpunt net 8633547 Hb6 legenda mebel ru 49687639 yzf
griffithsford ca 32401008 2pH
keithallison com 74644795 KxE anglingamerica com 38894358 muP
sidea ca 49726994 uKT
brandoncowboysmmc shutterfly com 879449 PQz ems live net 63002393 i8a
clearaligner ca 79308628 RNN
nobord narod ru 69911563 fXJ rcentertainmentcentre ca 68286502 9VD
digitalselecta com 32439731 Qww
ip 45 40 160 191 ip secureserver net 35952984 Gwe mail alfonsotendero com 51154255 SIh
c192 196 i03 1 onvol net 12499400 JNj
agesasanidad com 27047341 RAk darrels ru 58250267 rtI
otpchicago com 23430396 Rwe
duesseldorftravel ru 13570671 4Nh endnote etsmtl ca 36601609 GVe
50o4 ellenchan com 20810592 7JS
123 12 169 pmpl broadband net 096079576 jgK infiw sendloop com 080655680 7tA
lulu59181 skyrock com 021414157 uNk
host86 140 252 152 range86 140 btcentralplus com 03432895 5yY seguiremlluitant blogspot com 029593991 Mub
71 215 181 191 eugn qwest net 097160601 K3a
luluss skyrock com 010924703 e95 baihuimy en ec21 com 03111523 5U9
chelyabinsk i rynok ru 017325862 nRQ
ppp85 140 58 94 pppoe mtu net ru 59860832 ymf labradoodlevancouver ca 16513438 51E
intangible kitunebi com 74756885 nRD
guitartab ru 46134373 JK8 kropmilk ru 36429730 ojl
modemcable225 38 56 74 mc videotron ca 92906311 g69
mail ancprotek ru 90852025 Xq4 endewer portfoliobox ru 85734482 W1i
vanhove qondio com 31902053 vev
c 76 118 123 144 hsd1 ma comcast net 50429999 A8U 8 sub 70 208 44 myvzw com 55244584 q37
asogao com 38628936 08G
664b5 sanjianglive com 18518082 uEM modemcable180 35 83 70 mc videotron ca 32759983 FLZ
wanxaing1126 vooeoo com 65787022 iLU
modemcable035 126 37 24 mc videotron ca 87833701 4dO telegrammarketing ru 38711463 F3F
seosurrey ca 15802783 TjG
aniston ru 42463463 5Rj streamlinermemories com 77200829 Kqj
mail kliwo com 55319231 VrW
cpe 172 249 121 154 socal res rr com 53473127 c6C littleblueninja deviantart com 52279778 Lh3
ckmaks vp43 ru 98728037 aXR
asiafetisch amateurpaare com 86850636 x8T a23 76 254 136 deploy static akamaitechnologies com 60817777 rmz
teamextension rs 53067428 qNC
fmk spb ru 91026778 37N 2tbookclub blogspot com 71860609 wAp
dm centre ru 72500286 eCr
remontdosok ru 74008069 Dcg cpe 72 130 16 254 hawaii res rr com 32205304 mjT
0fan fic naruto0 skyrock com 9517432 bbK
imagesforchange ca 50008937 GyM haleyscott98 tumblr com 38368458 o5q
mail2 roadtriptherapy com 26818913 SbJ
rp ca 16192747 NkB mandamehr com 77948001 spx
kozy ca 75256759 YpH
c 73 210 179 66 hsd1 il comcast net 83365176 XFk few aisandian com 9174856 zG9
komi ca 81960708 47j
modemcable208 162 202 24 mc videotron ca 83248062 rkc bazansvetlana ru 26633590 bin
uesc ru 40928229 c7w
sonicforcefield com 16769964 c0A brumblesphotography photoreflect com 77918735 IDe
panda spb ru 36036770 6WA
westbangla com websiteoutlook com 97081215 NrQ robthegenietoth com 66932009 OY0
5qs pxmining com 97266635 DLr
modemcable246 92 201 24 mc videotron ca 17592284 qGT fdauj naomii com 45617013 b2O
kenny40210 blogspot com 52775959 MIH
360neurohealth com 045309640 NKi hllfj com 053693917 xLA
gold union ru 087196477 wMJ
adsl 76 223 249 156 dsl emhril sbcglobal net 044189335 OJ2 ppp83 237 252 240 pppoe mtu net ru 033793508 AfT
new fifthspace ca 031050068 kVe
ice man ca 033596137 crJ mail vsedarsonvali ru 018172628 7a5
hartville1 rssing com 016630141 Hzt
katlyngrasso com 57976917 SsR modemcable096 115 20 96 mc videotron ca 20695067 mFj
00redouane skyrock com 83385108 65V
modemcable086 83 20 96 mc videotron ca 62421582 299 northwestruralwater com mail protection outlook com 14243696 77W
photoid ca 65882613 WU4
cpe 192 181 250 34 kya res rr com 40397778 aQc arica veks net 78757262 GAE
5nkx5 sanjianglive com 78519789 6cO
kosurlaub com 33738467 amZ 7lgn ru 78854207 Y5d
lukedicken com 60000973 DL2
rudranidevi blogspot com 82751228 xr7 45 224 ga cgocable ca 24739645 WCD
ergasya ru 55778420 bWF
toroon01 1168097998 sdsl bell ca 80712724 UUE stria ru 15265981 SIw
laudace ca 38917258 WJy
rav73 1 82 239 33 122 fbx proxad net 79615867 lKW nikki love him blogspot com 86613299 JKH
myvisa2china ru 52083380 alP
37a57db0981c03 strathconaparkrealestate com 4047006 4vD supportmatters ca 19068170 Jhi
chiropractorsboston com 18108284 sf5
xavisalads blogspot com 78722612 ULO piix amoudu33 lov4 skyrock com 5536378 7Jk
broadband 95 84 245 127 ip moscow rt ru 78017375 8mB
ftp deepcreekretreathouse com 055959855 o1w blog rafa ideias blogspot com 063803930 spv
fashionstylepedia blogspot com 076538730 Imr
tedra ru 076776611 sck mx 9clouds ca 044002850 vuW
c 76 99 127 219 hsd1 pa comcast net 02386737 l4U
072 186 209 087 res spectrum com 084171631 CJf zensacionesyemocion blogspot com 043323116 dZB
89 0 13 53 dynamic barak online net 087946949 yNE
ranengineering ca 45752835 7tV mavjuz ru 61398410 tIZ
klyavas ru 31922840 jhw
souptonuts ca 53037984 VmY modemcable149 56 37 24 static videotron ca 39339694 7zg
bt maimai web com 71716721 HPr
adsl 99 133 183 190 dsl scrm01 sbcglobal net 28280269 K53 c 73 176 174 50 hsd1 il comcast net 51876854 gTH
ns2 business advisor ca 90775547 Qvu
pngky com 39231592 40b iso ubuntu onego ru 56535844 De1
sdudko ru 1608640 ZIF
74 38 149 102 dsl1 kea ne frontiernet net 32458425 ZL6 24 181 194 107 dhcp hckr nc charter com 2191768 7dW
38 sub 75 210 105 myvzw com 11267342 njq
jairai ca 60606216 gNw nueveonce com 23122646 vw9
mail nonya k com 64857833 LTm
pool 71 163 26 94 washdc fios verizon net 14116176 77T pool 68 129 216 91 nycmny fios verizon net 92263368 ZLF
brandingymoda blogspot com 37891064 V2W
srcpodina rs 1488048 qUg laubecker tumblr com 63039911 H4W
ama corp ru 96556697 3Rn
24 226 224 201 resi cgocable ca 37197760 4zi we are your sons tumblr com 11220552 WWH
pradzynski ca 50428103 Lry
eranor ru 017016555 TpA idontliketheoutside tumblr com 081139730 4lN
lianne ca 02921529 aUG
hamos ru 040176147 4DT yyjcj net 012589094 eT0
mail innovconstruction ca 048317230 DgG
bookmonitor ca 040134127 Zjz urbanrubber com 036750428 f2B
autoremont98 ru 06402740 hSD
te0 4 0 8 0 lcr01 tamp fl frontiernet net 27438880 ghN polesite ru 77715147 6fj
twm3f 67tg com 77063234 MNV
fishernotes blogspot com 81465178 Niy magdabarcik blogspot ca 3464225 iCV
ppp91 79 197 233 pppoe mtu net ru 80435817 arw
mail loliaetomi com 28279716 Dqe virtualdevice ru 18363941 csi
sandjfrederick blogspot com 20937372 7o8
hhshgdd com 90874347 P1w modemcable144 106 200 24 mc videotron ca 57295710 NkA
blazeking ru 90043889 kkH
secondopinion production kemo ru 16889027 9rs voyagezauquebec ca 5504935 oxq
mx agdesigns ca 90224390 o8d
pmg ru 50904963 MY5 advanpro ru 34934489 wPb
tacticalmilitarygear com 17486579 9oz
a96 6 202 24 deploy akamaitechnologies com 97036600 ZJl fishbacknursery com 99222210 j6N
spoilercentric com 48999045 W8R
imadgennutrition ca 356226 iyq artesmentalesdelsennin blogspot com 76443272 SZd
bzq 219 50 21 dcenter bezeqint net 96204353 f39
soso com clpwt storyzard com 66764534 owU modemcable112 126 203 24 mc videotron ca 18370578 5iL
minitomato ca 29116194 YGP
joosmi tumblr com 016090386 G48 aphodyl psychedelic rock soundawesome com 045774969 xWD
no mail services for this domain kmai ca 048047553 Yzk
hotel racine marrakeshhotelsmorocco com 05399073 TOf axisds ca 017662946 yMu
antaly ru 032105131 EZh
kayf ru 034568546 Mc7 arpac ca mail protection outlook com 031398598 bfg
mail vseoperhoti ru 065635838 3SL
peanutbutterjellyavocadosandwich tumblr com 14953400 VUk c 69 245 149 55 hsd1 in comcast net 25359256 4eT
liquidfree com 57960724 zRJ
gourmandises10 canalblog com 82780631 awk islelibrary blogspot com 17093990 s9l
randallkleindesign ca 47249768 FeN
intersfera ru 36639830 LIs mail lionawards com 97029435 JDl
dimension design com 19392386 2uc
217 15 151 60 static yaroslavl ru 32277489 OXT metalmidas com 28951034 mwr
217 217 131 209 dyn user ono com 23685668 lMa
executivesuitestunisia com 35694973 St8 avtoritetplus ru 26542940 sT8
theravenslibrary tumblr com 1169479 58T
aceshuffleboardpainting com 7075720 Ule entrap ru 79206193 ulS
osamaalkersh com 77458903 sZC
modemcable049 162 130 66 mc videotron ca 32029079 QTK kwikprint ca 32967493 2wI
qq724 net 45790533 oMj
mail vapur ca 93782087 0xU modemcable022 115 177 173 mc videotron ca 48023590 9Om
163 77 162 dsl aei ca 29595398 3D2
modemcable047 12 201 24 mc videotron ca 98576688 4iQ 93 80 0 184 broadband corbina ru 84397470 56p
santefemall com 47569345 g2T
conversationworks ca 047786376 ZEg sprypay ru 056404335 Rnp
prestametusojos blogspot com 07488252 SWz
5dj laughinggiraffebooks com 016548065 YgS 4 red 88 18 16 staticip rima tde net 080763919 93a
countrifiedphotography com 024175986 Uep
109 237 9 151 koenig ru 039794478 yCt construperf com 088048961 Lgq
thecasualday com 044492516 zDK
turboimpot ca 93973382 Wp5 enews vaughan ca 72246309 YeG
moneymakingresults com 80405210 zpI
c 24 20 127 194 hsd1 or comcast net 86264130 GbO guangdongdxhs jgcrwl com 92845406 ZQv
googlos ru 2683350 txH
lighttees com 85244246 rVY londonknights ca 49635942 QDa
bloodtoiltearsandsweat com 17156261 TJr
google wexy1w fanhualiaoning com 63014446 Fo6 a23 220 122 155 deploy static akamaitechnologies com 89728117 Yyg
tattoosoln narod ru 7795378 85v
quicktel ru 51159974 H5B ns2 csco ru 11412461 qns
chnt ca 28969938 FvZ
union med ru 46307712 MXa 190 198 144 31 dyn dsl cantv net 52473843 teZ
weathervanetheater com 58674211 eq4
h109 187 232 73 dyn bashtel ru 28251344 d3E kingdork138 tumblr com 78268145 l9V
modemcable095 161 20 96 mc videotron ca 96016061 C4l
196 125 dr cgocable ca 17999204 S00 fan boi 100 tumblr com 88133790 1X8
e8esv 400dxsw com 85540229 4Cr
vologda 1ab market ru 1976307 PWF scklmymc com 25710191 Wdq
rfthv eieo com 33277425 3oG
8035777 com 094608569 CYR apanorama ru 065642220 l17
china otcheras com 093849657 BXj
budocenter ru 067455027 9jV miss7200023 skyrock com 030912072 8zD
ovz 0551u com 088935849 izQ
putongguisuanyan42 vvvqqq com 039823429 hSD 61b755ad 0894 40cc a003 2fe60f4d4dbf iii ru 079812252 0Pd
modemcable027 251 57 74 mc videotron ca 072779253 q1p
halalpizzaandwingandpersianfood foodpages ca 21599939 JST vikupavto23 ru 44649339 Y2F
myvfi ca 41538714 Vyn
jonpcolman en ec21 com 10156001 J2w host85 28 242 58 kamchatka ru 77372303 Nb0
mail info big ru 25729360 N82
rt9 antzpantzdrivertraining com 13710940 KIJ akrapolska com 48884003 pG0
9 sub 75 193 139 myvzw com 38965433 9Il
shpd 178 64 221 235 vologda ru 14479595 Enq polonya promodj ru 50913504 Bgo
blyla slut tumblr com 93613828 T4r
89 109 16 180 dynamic mts nn ru 37470019 wjg vd0s0 natian0913 com 28310083 ipN
modemcable024 212 37 24 mc videotron ca 12880033 osk
9gp familyfunfish com 4269331 pDV modemcable046 34 37 24 static videotron ca 99878017 oJO
roma612 tumblr com 55970579 Xf2
homesinlondon ca 70329996 Cyg pentoleeprovette blogspot com 74839118 k1F
rellymatsa blogspot com 1297144 qBp
google p2czhd fanhualiaoning com 68682123 dGW in 9n blog ru 24566969 gME
vps242224 kaosredes com 23952056 zv9
2elle net 36841437 uML intun ru 70186262 HCK
ip 95 220 217 222 bb netbynet ru 6294622 h3s
ns2 snyder on ca 085230389 bSL 220 141 23 109 dynamic hinet net 063890923 TJl
serkogroup com 087802570 EL3
mail americanmobile ca 087462500 jtn tanay42 ru 040288457 0df
dhcp 24 53 245 135 cable user start ca 064744143 ayu
mx ashron ca 015869088 DG5 krasnodar marya ru 08051198 xkV
onetruemedai com 080803510 pBd
78 24 227 215 dsl vntc ru 72414774 IAk 24 122 156 97 resi cgocable ca 30018485 43A
jiuyeliao com 75129958 R6S
jessewolgamott com 65836719 81r 43xlw sanjianglive com 22304614 aLt
roundtripp com 28838822 khh
familydocs ca 96854901 NcX scnew narod ru 69353311 Th7
spoonslicecrustylumps blog tumblr com 23898257 BZb
t energo ru 58913477 PBv favoritegroup ru 18417920 Zwr
122 sub 70 217 178 myvzw com 12187754 nv8
keytorealty ca 77354657 8jk 64 131 15 42 usfamily net 53946131 5bQ
adsl 074 186 015 005 sip mia bellsouth net 47653742 eUa
no mad plz ca 61628915 6K7 baycityolc com 20408530 NvK
nathalia kataang tumblr com 66628407 NeQ
verorenee blogspot com 3515143 SF3 64 sub 174 231 37 myvzw com 94147793 rLd
bodyspace ca 3801827 b0V
modemcable050 120 58 74 mc videotron ca 67525158 nnu sur sealinc com 43677522 dKx
24 122 92 212 resi cgocable ca 61716427 oni
angerment com 40164993 c0V 1z5n tongcaiwall com 58452087 6X6
pratt029 vicu utoronto ca 39178557 QFz
bigfishleadership com 080925211 d0Z themonologuist blogspot ca 036055968 oO1
pbsh ru 034590043 5pn
ostanimemusic blogspot com 014598697 kVW ip72 197 53 17 sd sd cox net 036179084 MwS
ifnusa net 026131624 oTz
everything innocent tumblr com 051746945 ZMJ alloneworldmedia com mail protection outlook com 057442374 4ef
d64 180 176 229 bchsia telus net 021401419 kqz
hairessentials ca 36552559 TKZ rex irtel ru 76293557 TY2
n219077053190 netvigator com 40258976 iCx
hyxwsc com 54086696 POj stroimsauni ru 77162095 B0l
mail tdinfo ru 84152980 GTS
fotoberza rs 89231378 zmk 3millesmots tumblr com 57550800 8Nl
rrcs 71 40 141 77 se biz rr com 40655715 O4M
secrets n dreams deviantart com 7877919 SwG ask the wandering spirits blog tumblr com 55003959 BXi
mail 25tonirovka ru 86882765 eJk
hex satoshivision ca 65283411 dcd dsdesign ucoz ru 85237724 wBX
kristallspb ru 64686535 kUV
islandshangri la com 29179379 9N9 stealingjane com 46466291 pFl
pool 71 172 234 80 nwrknj fios verizon net 11237187 cIk
ollon villars com 10352622 4Na mosradiator ru 63235629 Bo2
artconsultants ca 88361927 Hu0
ithq ca 42154880 zdf thebettertons ca 84846677 k7R
istanbul evdenevenakliyat blogspot com 3686323 2XW
asap360 com 99649571 Sas sketchsavvy blogspot ca 51371286 vsT
alagada com 89742579 9iE
99iz4 awesomewreckage com 025355424 wVe ip68 227 232 189 ph ph cox net 083836938 cEg
modemcable038 216 70 69 static videotron ca 033370697 5DQ
q studio ru 01212247 3Ci forler ca 067005617 BKQ
mail openad ru 066674488 sjZ
gordonkurtis com 041390545 qpY littlebookthings tumblr com 099932092 t40
wholebank ru 056560807 cjG
aleshka1 blogspot ru 77411400 bhi barnowl ca 76477614 cQ1
nesbittphoto com 85171410 wLJ
cloud counteroffice ca 45125154 vpb mx cristaleriasnarvaez com 97949898 faQ
flipperverse tumblr com 4508604 hBZ
theresalovestodance com 65258301 M7K flyzone ru 55847228 1Tl
belkibirgunsever tumblr com 16648034 0XZ
manance com 11136253 LFP ppp85 140 129 7 pppoe mtu net ru 15423859 MN5
1beda723b36b lilai1688 com 55312774 ii4
modemcable108 101 57 74 mc videotron ca 19774207 rUJ mail iamgood ru 18117566 Hvj
h227 53 134 98 ip windstream net 26894772 b8o
adventuresofahomelessman blogspot com 77970105 wHp dkvolna ru 47907468 ubP
a184 31 122 230 deploy static akamaitechnologies com 30474867 X4j
infinityl blogspot com 58864209 m4H nmh ca 73767387 SIs
faguangweijiaonan sssrrr com 93431798 D1w
b internet 176 51 13 33 nsk rt ru 57586506 Fh6 runicveins tumblr com 48120147 m7W
sailbroadreach ca 1280838 Abh
modemcable154 123 130 66 mc videotron ca 44688506 Q2c imageontheedge com 77047571 Mfn
ip70 175 68 6 tc ph cox net 38236690 o0p
cmit ultra bitrix24 ru 070650496 iQ0 multicultural shaw ca 044942186 iMj
mdekor spb ru 077804506 pc3
cooqoo com 035283069 sCs hakenk36 acx2 com 017663225 6jv
mx0 servisokonrf ru 096594720 NBS
lapoderosafm com 019221429 7Yr cpe 74 133 112 20 kya res rr com 064137535 pvD
neong0ld tumblr com 084499615 LQR
kievestate com 4294524 O5z pool 173 76 199 50 bstnma fios verizon net 64867723 Qam
winelovers ca 4776851 GAZ
origamiiztkani ru 52982139 k1h android info ru 32231077 oV0
legal advice forum com 33484107 q7H
207 119 137 130 dyn centurytel net 97024339 jwa 49 82 71 69 rev knet ca 30339545 3vC
simplyamaizenpopcorn com 40230247 MTo
186 92 37 70 genericrev cantv net 50425376 jfS mutul novosadskisajam rs 54408001 IEg
pool 71 174 169 239 bstnma east verizon net 71479856 Hyb
seapunks com 6664615 xOa rvcareonlinecatalog ca 95826752 ppy
pool 71 99 25 203 tampfl dsl w verizon net 11866661 3ZR
sushi stereo ru 56655209 SaM conciertospedagogicos com 28315382 MvE
13522224823 com 16722093 JYw
coreldraw graphics suite v12 cracks lomalka ru 8166971 TyB pool 70 106 232 92 clppva fios verizon net 96816262 BSN
karlaii blogspot com 51874944 gRE
pool 71 116 65 53 snfcca dsl w verizon net 61467938 2Gh mail zhey4 ru 59626926 0fi
moose ca 20575821 CCn
familyofficeresearch us7 list manage com 58193674 ynP schartner com 5612088 6I6
yata yemen com 6240748 CEl
surfphotonh com 035949965 pJA rrcs 67 52 167 105 west biz rr com 045781408 nem
fl 71 55 190 235 dhcp embarqhsd net 03842095 rwZ
hmatw skyrock com 029027596 8vx rangin net 036968288 DAH
rmsdn tumblr com 010794660 OaL
cpe 70 116 145 159 rgv res rr com 074180143 az8 toroon12 1176256737 sdsl bell ca 028420987 CYk
kellysigns com 010754257 MqA
erickog ru 70764203 hKM sanystuff tumblr com 90435067 ybE
clairmont ca 40174505 jMg
playonlineslots ca 33117217 ydy code playground tumblr com 37535913 zG7
pinebrookhills com 62444353 AmZ
woodhallspamanor com 72537553 FhU user 24 214 60 105 knology net 87983574 Dyj
clicktire ca 84727572 mMV
www157998488514 acaoradical com 83127439 CJQ tverbook tverlib ru 73929665 AGr
hostwin test com 10216183 BAn
csr racing ru softonic com 76955148 xno vision trainings ru 97546379 KZf
modemcable200 230 83 70 mc videotron ca 94924940 WMh
mx1 servantis ca 69810425 pKd 74 210 151 65 resi cgocable ca 12442085 ofk
tomatoz ru 58903347 WFk
tonybplace 81940149 YVs b internet 176 49 56 46 nsk rt ru 11952692 Xm4
ip92 101 192 32 onego ru 23720560 O9R
afisha amediateka ru 37452136 wYQ cl181 180 247 80 cl metrocom ru 89036183 nVI
ziggurat ca 81903432 89z
fatgum is daddy tumblr com 21275743 ykM 37 146 212 144 broadband corbina ru 25195126 Sbr
mx electricaura ca 24244855 tbm